NutrigenixUSA

10 mg

Next-generation incretin-class reference peptide supplied in a holographic-sealed amber vial. Filled at 10 mg with lot-bound HPLC and mass-spectrometry documentation.

Form

Lyophilized peptide

Purity

≥ 99.3%

Molecular mass

4113.58 Da

Research Use Only — Not for Therapeutic or Diagnostic Use

30 mg

Higher-fill incretin-class reference peptide for extended in vitro protocols. Supplied in a holographic-sealed amber vial at 30 mg with lot-bound HPLC and mass-spectrometry documentation.

Form

Lyophilized peptide

Purity

≥ 99.3%

Molecular mass

4113.58 Da

Research Use Only — Not for Therapeutic or Diagnostic Use

40 mg

Maximum-fill incretin-class reference peptide for high-throughput or long-duration in vitro protocols. Supplied in a holographic-sealed amber vial at 40 mg with lot-bound HPLC and mass-spectrometry documentation.

Form

Lyophilized peptide

Purity

≥ 99.3%

Molecular mass

4113.58 Da

Research Use Only — Not for Therapeutic or Diagnostic Use

10 mg

Dual-component research stack combining BPC-157 and TB-500 reference peptides in one holographic-sealed amber vial at a 10 mg total fill, with lot-bound HPLC and mass-spectrometry documentation.

Form

Lyophilized peptide blend

Purity

≥ 99.0%

Molecular mass

BPC-157 1419.53 Da / TB-500 889.02 Da

Research Use Only — Not for Therapeutic or Diagnostic Use

80 mg

Research-grade quad-component blend of GHK-Cu, BPC-157, TB-500, and KV in one holographic-sealed amber vial at an 80 mg total fill, with lot-bound HPLC and mass-spectrometry documentation.

Form

Lyophilized peptide blend

Purity

≥ 99.0%

Research Use Only — Not for Therapeutic or Diagnostic Use

10 mg

Mitochondrial-derived peptide reference material supplied in a holographic-sealed amber vial at a 10 mg fill with lot-bound HPLC and mass-spectrometry documentation.

MRWQEMGYIFYPRKLR

Form

Lyophilized peptide

Purity

≥ 99.1%

Molecular mass

2174.61 Da

Research Use Only — Not for Therapeutic or Diagnostic Use

20 mg

Mid-fill mitochondrial-derived peptide reference material for multi-plate metabolic study designs. Holographic-sealed amber vial at 20 mg with lot-bound documentation.

MRWQEMGYIFYPRKLR

Form

Lyophilized peptide

Purity

≥ 99.1%

Molecular mass

2174.61 Da

Research Use Only — Not for Therapeutic or Diagnostic Use

30 mg

Higher-fill mitochondrial-derived peptide reference material for extended in vitro protocols. Holographic-sealed amber vial at 30 mg with lot-bound documentation.

MRWQEMGYIFYPRKLR

Form

Lyophilized peptide

Purity

≥ 99.1%

Molecular mass

2174.61 Da

Research Use Only — Not for Therapeutic or Diagnostic Use

40 mg

Maximum-fill mitochondrial-derived peptide reference material for high-throughput or long-duration metabolic research. Holographic-sealed amber vial at 40 mg with lot-bound documentation.

MRWQEMGYIFYPRKLR

Form

Lyophilized peptide

Purity

≥ 99.1%

Molecular mass

2174.61 Da

Research Use Only — Not for Therapeutic or Diagnostic Use

500 mg

Nicotinamide adenine dinucleotide, the flagship reference material in our catalog. Amber-sealed vials with lot-coded labels and full batch documentation.

Form

Lyophilized powder

Purity

≥ 99.2%

Molecular mass

663.43 g/mol

Research Use Only — Not for Therapeutic or Diagnostic Use

1000 mg

High-fill nicotinamide adenine dinucleotide reference material for extended in vitro protocols, supplied in a 10 mL holographic-capped vial at a 1000 mg fill with lot-bound HPLC and mass-spectrometry documentation.

Form

Lyophilized powder

Purity

≥ 99.2%

Molecular mass

663.43 g/mol

Research Use Only — Not for Therapeutic or Diagnostic Use

5 mg

Human cathelicidin antimicrobial peptide reference material for innate-immunity, biofilm, and host-defense model systems. Holographic-sealed vial at a 5 mg fill with lot-bound documentation.

[LL-37, 37 aa]

Form

Lyophilized peptide

Purity

≥ 99.0%

Molecular mass

4493.32 Da

Research Use Only — Not for Therapeutic or Diagnostic Use

10 mg

Alpha-MSH C-terminal tripeptide reference material for inflammatory-pathway and mucosal model research. Holographic-sealed vial at a 10 mg fill with lot-bound documentation.

KPV

Form

Lyophilized peptide

Purity

≥ 99.1%

Molecular mass

342.44 Da

Research Use Only — Not for Therapeutic or Diagnostic Use

10 mg

Pentadecapeptide reference material widely used in tissue-repair and gastrointestinal model systems. Supplied in a holographic-sealed amber vial at a 10 mg fill with lot-bound documentation.

GEPPPGKPADDAGLV

Form

Lyophilized peptide

Purity

≥ 99.1%

Molecular mass

1419.53 Da

Research Use Only — Not for Therapeutic or Diagnostic Use

70 mg

Tri-component research blend of GHK-Cu, BPC-157, and TB-500 in one holographic-sealed amber vial at a 70 mg total fill, with lot-bound HPLC and mass-spectrometry documentation.

Form

Lyophilized peptide blend

Purity

≥ 99.0%

Research Use Only — Not for Therapeutic or Diagnostic Use

10 mg

Dual-component secretagogue research blend pairing CJC-1295 (no DAC) with Ipamorelin in a holographic-sealed amber vial at a 10 mg total fill, with lot-bound documentation.

Form

Lyophilized peptide blend (No DAC)

Purity

≥ 98.9%

Molecular mass

CJC-1295 3367.90 Da / Ipamorelin 711.85 Da

Research Use Only — Not for Therapeutic or Diagnostic Use

5 mg

Delta sleep-inducing peptide reference material for sleep-architecture, neuroendocrine, and stress-response model systems. Holographic-sealed amber vial at a 5 mg fill.

WAGGDASGE

Form

Lyophilized peptide

Purity

≥ 99.0%

Molecular mass

848.81 Da

Research Use Only — Not for Therapeutic or Diagnostic Use

10 mg

Thymosin beta-4 active fragment supplied in a holographic-sealed amber vial at a 10 mg fill, with lot-bound HPLC purity and mass-spectrometry identity confirmation for actin-binding and cell-migration research.

LKKTETQ

Form

Lyophilized peptide

Purity

≥ 99.0%

Molecular mass

889.02 Da

Research Use Only — Not for Therapeutic or Diagnostic Use

10 mg

Selective pentapeptide growth-hormone secretagogue and GHS-R1a agonist reference material supplied in a holographic-sealed vial at a 10 mg fill, with lot-bound HPLC and mass-spectrometry documentation.

Aib-His-D-2-Nal-D-Phe-Lys-NH2

Form

Lyophilized peptide

Purity

≥ 99.0%

Molecular mass

711.85 Da

Research Use Only — Not for Therapeutic or Diagnostic Use

5 mg

ACTH(4-10) analog reference peptide supplied in a holographic-sealed amber vial at a 5 mg fill, with lot-bound HPLC and mass-spectrometry documentation for neurotrophic-expression research.

MEHFPGP

Form

Lyophilized peptide

Purity

≥ 99.0%

Molecular mass

813.91 Da

Research Use Only — Not for Therapeutic or Diagnostic Use

10 mg

ACTH(4-10) analog used in neurotrophic factor expression and cognition-model investigations. Holographic-sealed amber vial at a 10 mg fill with lot-bound documentation.

MEHFPGP

Form

Lyophilized peptide

Purity

≥ 99.0%

Molecular mass

813.91 Da

Research Use Only — Not for Therapeutic or Diagnostic Use

5 mg

Tuftsin analog reference peptide supplied in a holographic-sealed amber vial at a 5 mg fill, with lot-bound documentation for anxiolytic-pathway and neuroimmune research.

TKPRPGP

Form

Lyophilized peptide

Purity

≥ 98.9%

Molecular mass

751.90 Da

Research Use Only — Not for Therapeutic or Diagnostic Use

10 mg

Tuftsin analog reference peptide for anxiolytic-pathway and neuroimmune research. Holographic-sealed amber vial at a 10 mg fill with lot-bound documentation.

TKPRPGP

Form

Lyophilized peptide

Purity

≥ 98.9%

Molecular mass

751.90 Da

Research Use Only — Not for Therapeutic or Diagnostic Use

50 mg

Copper tripeptide-1 used in collagen synthesis, wound-model, and dermal matrix research.

GHK (Cu²⁺ complex)

Form

Copper peptide powder

Purity

≥ 99.0%

Molecular mass

402.93 Da

Research Use Only — Not for Therapeutic or Diagnostic Use

10 mg

Mitochondrial-targeted tetrapeptide reference material supplied in a holographic-sealed amber vial at a 10 mg fill, with lot-bound HPLC and mass-spectrometry documentation.

D-Arg-Dmt-Lys-Phe-NH2

Form

Lyophilized peptide

Purity

≥ 99.0%

Molecular mass

639.80 Da

Research Use Only — Not for Therapeutic or Diagnostic Use

10 mg

Cyclic nonapeptide reference material for oxytocin receptor (OXTR) binding and social-behavior signaling study designs. Supplied as a lyophilized peptide with lot-coded documentation.

CYIQNCPLG (C-terminal amide; disulfide Cys1–Cys6)

Form

Lyophilized peptide

Purity

≥ 99.0%

Molecular mass

1007.19 Da

Research Use Only — Not for Therapeutic or Diagnostic Use

10 mg

N-acetyl-5-methoxytryptamine reference material for MT1/MT2 receptor-binding and circadian-signaling research, supplied in a holographic-sealed vial with lot-bound HPLC documentation.

Form

Lyophilized indoleamine

Purity

≥ 99.0%

Molecular mass

232.28 Da

Research Use Only — Not for Therapeutic or Diagnostic Use

5 mg

Cyclic heptapeptide melanocortin-receptor reference material (bremelanotide) supplied at a 5 mg fill for MC3R/MC4R binding and CNS signaling research, with lot-coded HPLC and MS documentation.

Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-OH

Form

Lyophilized peptide

Purity

≥ 99.0%

Molecular mass

1025.18 Da

Research Use Only — Not for Therapeutic or Diagnostic Use

10 mg

Synthetic thymic peptide reference material for immune-modulation, TLR signaling, and T-cell differentiation research. Supplied in a holographic-sealed amber vial at a 10 mg fill with lot-bound HPLC and mass-spectrometry documentation.

Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn-OH

Form

Lyophilized peptide

Purity

≥ 99.0%

Molecular mass

3108.34 Da

Research Use Only — Not for Therapeutic or Diagnostic Use

10 mg

Synthetic GHRH analog reference material for growth-hormone release, lipolysis, and metabolic pathway research. Supplied in a holographic-sealed amber vial at a 10 mg fill with lot-bound HPLC and mass-spectrometry documentation.

Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2

Form

Lyophilized peptide

Purity

≥ 99.0%

Molecular mass

5135.86 Da

Research Use Only — Not for Therapeutic or Diagnostic Use

20 mg

Synthetic Glu-Asp dipeptide reference material for bladder-epithelium, urinary-tract, and gene-expression research. Supplied in a holographic-sealed amber vial at a 20 mg fill with lot-bound HPLC and mass-spectrometry documentation.

Glu-Asp (ED)

Form

Lyophilized peptide

Purity

≥ 99.0%

Molecular mass

262.22 Da

Research Use Only — Not for Therapeutic or Diagnostic Use

10 mL sterile solution

Reconstitution Solution — a sterile 10 mL bacteriostatic-grade diluent formulated for reconstituting lyophilized research peptides. Supplied in a sealed multi-dose vial for laboratory reference workflows. Research use only.

Form

Solution (10 mL vial)

Purity

Sterile, USP grade

Molecular mass

10 mL per vial

Research Use Only — Not for Therapeutic or Diagnostic Use

1 mL · 31G × 6 mm · 100 count

Disposable Insulin Syringes — a box of 100 sterile, single-use 1 mL syringes with a fixed 31G × 6 mm needle and 100-unit graduations for accurate small-volume measurement in laboratory workflows. Non-bacteria, non-toxic, non-pyrogenic. Research use only.

Form

Sterile single-use syringes (box of 100)

Purity

Non-pyrogenic, non-toxic, sterile

Molecular mass

1 mL (100 unit) barrel, 31G × 1/4" (6 mm) needle

Research Use Only — Not for Therapeutic or Diagnostic Use

70% isopropyl alcohol · 100 count

Alcohol Prep Pads — a box of 100 individually wrapped sterile medium pads made with 70% isopropyl alcohol for topical antiseptic surface and skin preparation. Thick pads with excellent cleansing action, single use only, not made with natural rubber latex.

Form

Sterile medium prep pads (box of 100)

Purity

70% v/v isopropyl alcohol, sterile

Molecular mass

Medium thick pad, individually wrapped

Research Use Only — Not for Therapeutic or Diagnostic Use

5 mg + 5 mg per vial

TESA + IPA — a dual GHRH/GHS secretagogue blend pairing 5 mg tesamorelin (a 44-aa GHRH analog) with 5 mg ipamorelin (a pentapeptide GH secretagogue) in a single 10 mL vial. Supplied as lyophilized reference material for growth-hormone axis and receptor-binding research. Research use only.

Form

Lyophilized powder (10 mL vial)

Purity

≥ 98% (HPLC)

Molecular mass

10 mg total (5 mg tesamorelin + 5 mg ipamorelin)

Research Use Only — Not for Therapeutic or Diagnostic Use

500 mg per 6 mL serving

Liposomal reduced glutathione in a sunflower-lecithin phospholipid delivery system — 500 mg glutathione plus 250 mg phospholipids per 6 mL teaspoon, 30 servings per bottle. Non-GMO, gluten-free, third-party tested, made in the USA. Dietary supplement, not a research chemical.

gamma-Glu-Cys-Gly (reduced glutathione)

Form

Liposomal liquid supplement (6 fl oz / 180 mL)

Purity

Third-party tested

Molecular mass

307.32 Da

Research Use Only — Not for Therapeutic or Diagnostic Use

500 mg per 6 mL serving

Liposomal quercetin from Sophora japonica in a sunflower-lecithin phospholipid delivery system — 500 mg quercetin plus 250 mg phospholipids per 6 mL teaspoon, 30 servings per bottle. Supports immune health, healthy inflammation response, cardiovascular health, and histamine balance. Non-GMO, gluten-free, third-party tested, made in the USA. Dietary supplement, not a research chemical.

Form

Liposomal liquid supplement (6 fl oz / 180 mL)

Purity

Third-party tested

Molecular mass

302.24 Da

Research Use Only — Not for Therapeutic or Diagnostic Use

700 mg per 1 mL serving

Microsomal Ashwagandha with KSM-66 and CO2 extract — 600 mg full-spectrum KSM-66 root extract (standardized to 5% withanolides) plus 100 mg supercritical CO2 extract per 1 mL dropper, 59 servings per bottle. Supports stress relief, mental well-being, calm mood, and cognitive function. USDA Organic, Non-GMO Project Verified, made in the USA. Dietary supplement, not a research chemical.

Form

Microsomal liquid supplement (2 fl oz / 59.2 mL)

Purity

USDA Organic · Non-GMO Verified

Molecular mass

600 mg KSM-66 + 100 mg CO2 extract

Research Use Only — Not for Therapeutic or Diagnostic Use

1,890 mg per 3-capsule serving

Complete Liver Complex (CLC) — a synergistic capsule blend built to support the liver's phase I and phase II conjugation detoxification pathways. Each 3-capsule serving delivers NAC, gamma-glutamylcysteine, calcium D-glucarate, phosphatidylcholine, glycine, artichoke leaf extract, DHM, NACET, taurine, selenium, and molybdenum. 90 capsules, 30 servings. Dietary supplement, not a research chemical.

Form

Vegetable capsules (90 capsules / 30 servings)

Purity

Third-party tested

Molecular mass

NAC 400 mg · GGC 300 mg · CDG 300 mg

Research Use Only — Not for Therapeutic or Diagnostic Use

6.58 g per scoop (30 servings)

Peak Amino — a naturally mango-flavored essential amino acid (EAA) powder delivering all 9 essential aminos per 6.58 g scoop, led by 2,000 mg L-leucine. Formulated for muscle building, athletic recovery, and hydration support. Milk free, sugar free, gluten free, non-GMO, and third-party tested. 30 servings per container. Dietary supplement, not a research chemical.

Form

Mango-flavored powder (7.0 oz / 197.3 g)

Purity

Third-party tested

Molecular mass

9 essential amino acids · 5,000 mg total EAA

Research Use Only — Not for Therapeutic or Diagnostic Use

200 mcg per capsule (60 capsules)

Selenium 200 mcg — a high-potency essential trace mineral supplied as L-selenomethionine, the highly bioavailable organic form. One capsule daily supports immune system health, antioxidant defense, and normal thyroid function. 60 capsules, 60 servings. Dietary supplement, not a research chemical.

Form

Vegetable capsules (60 capsules / 60 servings)

Purity

Third-party tested

Molecular mass

200 mcg selenium as L-selenomethionine (364% DV)

Research Use Only — Not for Therapeutic or Diagnostic Use

2,100 mg per 3-capsule serving

Magnesium L-Threonate — a highly absorbable chelated magnesium delivering 2,100 mg of magnesium L-threonate (151 mg elemental magnesium) per 3-capsule serving. Formulated for targeted cognitive support, sleep quality, muscle relaxation, and everyday wellness. 90 capsules, 30 servings. Dietary supplement, not a research chemical.

Form

Capsules (90 capsules / 30 servings)

Purity

Third-party tested

Molecular mass

2,100 mg magnesium L-threonate (151 mg elemental Mg)

Research Use Only — Not for Therapeutic or Diagnostic Use

500 mg per capsule

Urolithin A 500 mg — a postbiotic ellagitannin metabolite formulated for longevity and cellular energy support, including cellular renewal, energy and endurance, and healthy aging. One capsule daily, 60 servings per bottle. Vegan, non-GMO, gluten free, GMP quality, with zero fillers, binders, or artificial color. Dietary supplement, not a research chemical.

Form

Capsules (60 capsules / 60 servings)

Purity

Third-party tested

Molecular mass

500 mg Urolithin A per capsule

Research Use Only — Not for Therapeutic or Diagnostic Use

Advanced formula / 2 capsules

Berberinex — an enhanced-absorption metabolic support complex with dihydroberberine, bitter melon, cinnamon, chromium, biotin, sea buckthorn, alpha-lipoic acid, banaba, gymnema, fucoxanthin, Panax ginseng, and astragalus. Two capsules daily, 30 servings. Dietary supplement, not a research chemical.

Form

Capsules (60 capsules / 30 servings)

Purity

GMP quality

Molecular mass

1,115 mg disclosed actives plus 638 mg proprietary blend

Research Use Only — Not for Therapeutic or Diagnostic Use

Primal Force Complex / 2 capsules

Alpha Stack — a synergistic bio-optimization blend led by 500 mg each of Fadogia agrestis, Tongkat Ali, and Turkesterone, with 100 mg Mucuna pruriens 98% L-Dopa, Tribulus, ashwagandha, fenugreek, shilajit, pine pollen, and black pepper extract. Two capsules daily, 30 servings. Dietary supplement, not a research chemical.

Form

Capsules (60 capsules / 30 servings)

Purity

GMP quality

Molecular mass

1,600 mg principal actives plus botanical blend

Research Use Only — Not for Therapeutic or Diagnostic Use

500 mg per 2-capsule serving

TUDCA Pro — a dual-source digestive and bile-support formula delivering 250 mg tauroursodeoxycholic acid and 250 mg desiccated ox bile extract per 2-capsule serving. Naturally gluten free, non-GMO, and made with vegetable capsules. 30 servings per bottle. Dietary supplement, not a research chemical.

Form

Capsules (60 capsules / 30 servings)

Purity

GMP quality

Molecular mass

250 mg TUDCA + 250 mg desiccated ox bile extract

Research Use Only — Not for Therapeutic or Diagnostic Use

75 mg per capsule

Zinc Carnosine — a gastrointestinal support complex combining 75 mg zinc L-carnosine (16 mg elemental zinc), 300 mg deglycyrrhizinated licorice, and 250 mg mastic gum per capsule. Vegan, non-GMO, naturally gluten free, and GMP certified. 60 servings per bottle. Dietary supplement, not a research chemical.

Form

Capsules (60 capsules / 60 servings)

Purity

GMP certified

Molecular mass

75 mg zinc L-carnosine + 300 mg DGL + 250 mg mastic gum

Research Use Only — Not for Therapeutic or Diagnostic Use

2,800 mg per 4-capsule serving

Mag Booster — an advanced magnesium and calm-focus complex delivering 2,000 mg magnesium L-threonate, 600 mg Sucrosomial® UltraMag™, 150 mg theanine, and 50 mg apigenin per 4-capsule serving. Formulated for natural magnesium support, stress relief, and mental focus. 120 capsules, 30 servings. Dietary supplement, not a research chemical.

Form

Capsules (120 capsules / 30 servings)

Purity

GMP quality

Molecular mass

2,000 mg magnesium L-threonate + 600 mg sucrosomial magnesium + 150 mg L-theanine + 50 mg apigenin

Research Use Only — Not for Therapeutic or Diagnostic Use

500 mg magnesium per 4-tablet serving

NutriMag — a sustained-release magnesium formula with 8-hour absorption technology, delivering 500 mg elemental magnesium as dimagnesium malate plus methylated B6, folate, and B12 per 4-tablet serving. Formulated for muscle function and nervous system support. Non-GMO, gluten-free, vegan. 240 tablets, 60 servings. Dietary supplement, not a research chemical.

Form

Sustained-release tablets (240 tablets / 60 servings)

Purity

GMP quality

Molecular mass

Magnesium (as dimagnesium malate) 500 mg + malic acid 1,436 mg + B6 5 mg + folate 200 mcg DFE + B12 6 mcg

Research Use Only — Not for Therapeutic or Diagnostic Use

120 mcg per capsule

GHK-Cu — an oral copper tripeptide supplement delivering 120 mcg of GHK-Cu (glycyl-L-histidyl-L-lysine copper complex) per capsule. GHK-Cu is a naturally occurring copper peptide studied for its roles in skin, connective tissue, and cellular signaling. 90 capsules per bottle. Dietary supplement, not a research chemical.

Gly-His-Lys · Cu(II)

Form

Capsules (90 capsules / 90 servings)

Purity

GMP quality

Molecular mass

GHK-Cu 120 mcg per capsule

Research Use Only — Not for Therapeutic or Diagnostic Use

2 capsules per serving

KPV MAX — a targeted tripeptide complex combining KPV (Lys-Pro-Val) 500 mcg with palmitoylethanolamide (PEA) 500 mg, sodium bicarbonate 400 mg, and hyaluronic acid 100 mg per 2-capsule serving. KPV is a naturally occurring tripeptide studied for gut, skin, and cellular-signaling support; PEA is an endogenous fatty-acid amide researched for comfort and inflammatory balance. 60 capsules, 30 servings. Dietary supplement, not a research chemical.

Lys-Pro-Val

Form

Capsules (60 capsules / 30 servings)

Purity

GMP quality

Molecular mass

KPV 500 mcg + PEA 500 mg + sodium bicarbonate 400 mg + hyaluronic acid 100 mg per serving

Research Use Only — Not for Therapeutic or Diagnostic Use

50 mg per capsule

5-Amino-1-MQ — an oral supplement delivering 50 mg of 5-amino-1-methylquinolinium per capsule. 5-Amino-1-MQ is a small-molecule NNMT (nicotinamide N-methyltransferase) inhibitor studied in the literature for its roles in cellular NAD+ metabolism and metabolic signaling. 60 capsules per bottle. Dietary supplement, not a research chemical.

Form

Capsules (60 capsules / 60 servings)

Purity

GMP quality

Molecular mass

5-Amino-1-methylquinolinium 50 mg per capsule

Research Use Only — Not for Therapeutic or Diagnostic Use

500 mcg per capsule

TB-500 Capsules — an oral supplement delivering 500 mcg of TB-500 (the active-region fragment of Thymosin Beta-4) per capsule. TB-500 is a synthetic fragment studied in the literature for its roles in actin regulation, cell migration, and tissue-repair signaling. 90 capsules per bottle. Dietary supplement, not a research chemical.

Ac-SDKP region (Thymosin Beta-4 fragment)

Form

Capsules (90 capsules / 90 servings)

Purity

GMP quality

Molecular mass

TB-500 500 mcg per capsule

Research Use Only — Not for Therapeutic or Diagnostic Use

2 capsules per serving

FLOW MAX — an advanced cognitive-flow complex combining tesofensine 250 mcg, taurine 500 mg, and magnesium L-threonate 350 mg per 2-capsule serving. Formulated for focus, drive, and mental clarity support. 60 capsules, 30 servings. Dietary supplement, not a research chemical.

Form

Capsules (60 capsules / 30 servings)

Purity

GMP quality

Molecular mass

Tesofensine 250 mcg + Taurine 500 mg + Magnesium Threonate 350 mg per serving

Research Use Only — Not for Therapeutic or Diagnostic Use

250 mcg per capsule

SLU-PP-332 — an oral supplement delivering 250 mcg of SLU-PP-332, a synthetic pan-ERR (estrogen-related receptor) agonist, per capsule. SLU-PP-332 is studied in the literature for its roles in exercise-mimetic metabolic signaling and mitochondrial function. 90 capsules per bottle. Dietary supplement, not a research chemical.

Form

Capsules (90 capsules / 90 servings)

Purity

GMP quality

Molecular mass

SLU-PP-332 250 mcg per capsule

Research Use Only — Not for Therapeutic or Diagnostic Use

500 mcg per capsule

Tesofensine — an oral supplement delivering 500 mcg of tesofensine per capsule. Tesofensine is a triple monoamine reuptake inhibitor studied in the literature for its roles in appetite signaling, energy balance, and neurotransmitter modulation. 90 capsules, 90 servings. Dietary supplement, not a research chemical.

Form

Capsules (90 capsules / 90 servings)

Purity

GMP quality

Molecular mass

Tesofensine 500 mcg per capsule

Research Use Only — Not for Therapeutic or Diagnostic Use

2 capsules per serving

BPC-157 MAX — an advanced oral complex combining BPC-157 (as arginine salt) with palmitoylethanolamide (PEA), sodium bicarbonate, and hyaluronic acid per 2-capsule serving. BPC-157 is studied in the literature for its roles in tissue-repair and gut-barrier signaling; the buffered formula is designed for oral stability. 60 capsules, 30 servings. Dietary supplement, not a research chemical.

Form

Capsules (60 capsules / 30 servings)

Purity

GMP quality

Molecular mass

BPC-157 (arginine salt) 1000 mcg + PEA 500 mg + Sodium Bicarbonate 400 mg + Hyaluronic Acid 100 mg per serving

Research Use Only — Not for Therapeutic or Diagnostic Use

2 capsules per serving

GHK-Cu MAX — an advanced oral complex combining GHK-Cu (copper tripeptide) 5 mg with palmitoylethanolamide (PEA), sodium bicarbonate, and hyaluronic acid per 2-capsule serving. GHK-Cu is studied in the literature for its roles in skin-remodeling, collagen synthesis, and antioxidant signaling. 60 capsules, 30 servings. Dietary supplement, not a research chemical.

Form

Capsules (60 capsules / 30 servings)

Purity

GMP quality

Molecular mass

GHK-Cu 5 mg + PEA 500 mg + Sodium Bicarbonate 400 mg + Hyaluronic Acid 100 mg per serving

Research Use Only — Not for Therapeutic or Diagnostic Use

1 capsule per serving

BPC-157 Capsules — a single-ingredient oral formula delivering 500 mcg of BPC-157 per capsule. BPC-157 is a pentadecapeptide studied in the literature for its roles in tissue-repair signaling and gut-barrier support. 90 capsules, 90 servings. Dietary supplement, not a research chemical.

Form

Capsules (90 capsules / 90 servings)

Purity

GMP quality

Molecular mass

BPC-157 500 mcg per capsule

Research Use Only — Not for Therapeutic or Diagnostic Use

2 capsules per serving

KPV Capsules — a single-ingredient oral formula delivering 250 mcg of the tripeptide KPV (Lys-Pro-Val) per 2-capsule serving. KPV is the C-terminal fragment of alpha-MSH, studied in the literature for gut-barrier integrity, mucosal health, and inflammatory signaling. 60 capsules, 30 servings. Dietary supplement, not a research chemical.

Lys-Pro-Val

Form

Capsules (60 capsules / 30 servings)

Purity

GMP quality

Molecular mass

KPV 250 mcg per 2-capsule serving

Research Use Only — Not for Therapeutic or Diagnostic Use